SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_012165839.1.67183 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012165839.1.67183
Domain Number 1 Region: 61-166
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 2.09e-28
Family Pentapeptide repeats 0.0006
Further Details:      
 
Domain Number 2 Region: 181-288
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 6.15e-28
Family Pentapeptide repeats 0.00044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_012165839.1.67183
Sequence length 299
Comment hypothetical protein [Acaryochloris marina]; AA=GCF_000018105.1; RF=representative genome; TAX=329726; STAX=155978; NAME=Acaryochloris marina MBIC11017; strain=MBIC11017; AL=Complete Genome; RT=Major
Sequence
MQTVLIWVDYMKQLNKGSLVIGTALASFSIAFLPLSAASNSAQTPNPEHLQQLQATNSCD
GCDLRGANLQDQNLKGASLQGANLQGANLQGVNLDDANLESANLKYANLSKATLRRASLT
TTLKQATNLQDANLTQATLVKTKLKGADLRRANLFEATLEDADFSVAVVETTQGIRRVYF
SDLREANFNKSNLKNATLNQVYLSNANLSEANLKGAKLKQAQLKYTNLNGAKLNNADLRK
ASLESVNLSEADLSSAHLGKIAMKDVNLRGANLSNADLSGAKLCQMDIPASLQALATCK
Download sequence
Identical sequences B0CG68
329726.AM1_5674 WP_012165839.1.67183 gi|158338763|ref|YP_001519940.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]