SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_012168212.1.67183 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012168212.1.67183
Domain Number 1 Region: 320-447
Classification Level Classification E-value
Superfamily Apolipoprotein 0.000000235
Family Apolipoprotein 0.018
Further Details:      
 
Weak hits

Sequence:  WP_012168212.1.67183
Domain Number - Region: 133-300
Classification Level Classification E-value
Superfamily Apolipoprotein A-I 0.00785
Family Apolipoprotein A-I 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_012168212.1.67183
Sequence length 550
Comment hypothetical protein [Acaryochloris marina]; AA=GCF_000018105.1; RF=representative genome; TAX=329726; STAX=155978; NAME=Acaryochloris marina MBIC11017; strain=MBIC11017; AL=Complete Genome; RT=Major
Sequence
MPIHQAAQNQTHEVQEANARAVEGSARMIAEAMRMSFRLMRMAQRNAQQLSQQYGSGASD
SDTPDPDTPDLDEDIELNPREENELSQEADIQLNPEQDITIKVGKTTVYPIPEDTQLEQA
DVDNLIAALENPEQLQEEVTVFATQTLPDGSKSNENVFHAVPGEVKYDPHKLVEAFAQQK
VEQQDETLSQDQEPAQIVIEGETRPMSWDTPVVNQAAAPIIENIKNKVTQGAEAIKDRAA
NALERQNLLNMAFKGGTVARAAYDQAAQIPGRAEKLKEVVAQVKEKTGQAIAEVREKAKD
LDPKQLIQGKDPVQGPELPSLDDRISTLQSQVGDLQWQMNDLQDQLKSVDAKLDVIVNRT
NPPEQSNNVDKWHNNLGGMVKEKLQQIKEKITTAIQSIKDKISEVINNFKATAFDKVEQA
KEKVTEVKDNVTSRVDNTVQSVRQGIADIQAGMTNAAVAKLVQQYGQEQPDGSRVYNGDR
FSYQTQGDSVTISAKGRGNVFQNGQLTDKANVQDAQAIQALPAKVEQEFAHQQSEKATAS
QAVGAGGRRR
Download sequence
Identical sequences A8ZPU2
329726.AM1_F0149 WP_012168212.1.67183 gi|158341184|ref|YP_001522453.1| gi|158341184|ref|YP_001522453.1|NC_009931

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]