SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_012173254.1.71355 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_012173254.1.71355
Domain Number - Region: 107-208
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 0.045
Family D-glucarate dehydratase-like 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_012173254.1.71355
Sequence length 250
Comment hypothetical protein [Deinococcus geothermalis]; AA=GCF_000196275.1; RF=representative genome; TAX=319795; STAX=68909; NAME=Deinococcus geothermalis DSM 11300; strain=DSM 11300; AL=Complete Genome; RT=Major
Sequence
MTRRDLQRVTAKLQPDQVSQVLDTVTVLQTRRLARKVITVRLIGQGELLLDGVRVDLHSH
TARAAVLLNQLHVQPELSTAQIAETVFDQDLTPMPSDEARKVKTQVSALVLKLRKAFGEA
VILRTGPQNSSTYQLGRALYQVVVDLDQLEEDLRAGPERLPHVAHALRSGILTGESLVWA
TDRRDQVFGHFREALMEAVQRCGSEVQLAGLAKSIALFSATEGVLAEEVHPLFAALALAR
ARLGMPVLKQ
Download sequence
Identical sequences A8ZRM5
gi|158421605|ref|YP_001527832.1|NC_009939 gi|158421605|ref|YP_001527832.1| WP_012173254.1.71355 319795.Dgeo_3094

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]