SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_012181798.1.86246 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012181798.1.86246
Domain Number 1 Region: 3-40
Classification Level Classification E-value
Superfamily YaeB-like 0.0000262
Family YaeB-like 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_012181798.1.86246
Sequence length 76
Comment MULTISPECIES: hypothetical protein [Salinispora]; AA=GCF_000514615.1; RF=na; TAX=1136428; STAX=168697; NAME=Salinispora arenicola CNT850; strain=CNT850; AL=Scaffold; RT=Major
Sequence
MATPVRPNPIGLSAVQLRNRMIVSARRIIVEHWLRVDRCPVCGCGWPCPPTVYAYDYLTS
VGQGSWTPPGHVLGRR
Download sequence
Identical sequences A8LVM4
391037.Sare_1599 WP_012181798.1.102098 WP_012181798.1.10772 WP_012181798.1.12870 WP_012181798.1.14007 WP_012181798.1.17051 WP_012181798.1.20048 WP_012181798.1.23841 WP_012181798.1.2519 WP_012181798.1.25902 WP_012181798.1.26117 WP_012181798.1.28651 WP_012181798.1.28976 WP_012181798.1.29185 WP_012181798.1.29984 WP_012181798.1.30836 WP_012181798.1.33355 WP_012181798.1.35493 WP_012181798.1.3656 WP_012181798.1.37892 WP_012181798.1.45982 WP_012181798.1.51738 WP_012181798.1.58464 WP_012181798.1.68706 WP_012181798.1.69805 WP_012181798.1.7007 WP_012181798.1.76773 WP_012181798.1.77205 WP_012181798.1.86246 WP_012181798.1.89801 WP_012181798.1.98430 WP_012181798.1.98445 WP_012181798.1.99814 gi|159037230|ref|YP_001536483.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]