SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_012183618.1.20048 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012183618.1.20048
Domain Number 1 Region: 20-295
Classification Level Classification E-value
Superfamily Transmembrane di-heme cytochromes 2.83e-60
Family Cytochrome b of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) 0.0000297
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_012183618.1.20048
Sequence length 536
Comment menaquinol-cytochrome c reductase cytochrome b subunit [Salinispora arenicola]; AA=GCF_000514875.1; RF=na; TAX=1137257; STAX=168697; NAME=Salinispora arenicola CNX508; strain=CNX508; AL=Scaffold; RT=Major
Sequence
MKRRKFEMAAVPGNVARGVDDRFQVATPLRRLLNKVFPDHWSFLLGEIALFSFIILLLTG
VFLTFFFEPAMTEVIYNGSYAPLRGTPMSAAYASSLDISFDIRGGLIMRQMHHWSALLFM
AAIVVHMMRVFFTGAFRKPREANWIIGSLLFWVGFLAGFTGYSLPDDGLSGTGLRIASGI
MLSIPVIGSWLTSSIFNGEFPGTIIISRFYIAHVLLIPGLLLALIGAHLGLVFKQKHTQW
PGPGRTNDNVVGERMFPRYALKQGGFFMVVFGVIALMGGLLQINPIWLFGPYEAWVVSAA
SQPDWYVMFLDGSTRLMPAWEIYIPIGDGYVIPPLFWPTVVLPGLLVGMSVLYPFIEARR
LKDHRSHNLLQRPRDVPARTGLGAMAVTFYLVLALSGANDVIADKFNISLNAMTWGGRIG
LLLLPPLAYYVTYRICLGLQQHDREVLAHGVETGIIRRLPDGRFVEVHQPLHAEDGELEY
VGWVVPKKMNRLGALGPAIRGFFYPIEKPAEAPVSPGHPPVESDAEQSEITSGERR
Download sequence
Identical sequences A8LYB8
391037.Sare_3524 WP_012183618.1.102098 WP_012183618.1.18430 WP_012183618.1.20048 WP_012183618.1.23841 WP_012183618.1.23871 WP_012183618.1.24936 WP_012183618.1.32557 WP_012183618.1.33355 WP_012183618.1.35493 WP_012183618.1.51738 WP_012183618.1.61781 WP_012183618.1.63836 WP_012183618.1.68706 WP_012183618.1.69805 WP_012183618.1.7007 WP_012183618.1.75797 WP_012183618.1.76231 WP_012183618.1.77205 WP_012183618.1.79888 WP_012183618.1.806 WP_012183618.1.8104 WP_012183618.1.81166 WP_012183618.1.83049 WP_012183618.1.88482 WP_012183618.1.91622 WP_012183618.1.98445 gi|159039064|ref|YP_001538317.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]