SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_012186899.1.60673 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012186899.1.60673
Domain Number 1 Region: 7-184
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 3.4e-47
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_012186899.1.60673
Sequence length 187
Comment pyruvate oxidoreductase subunit gamma [Caldivirga maquilingensis]; AA=GCF_000018305.1; RF=representative genome; TAX=397948; STAX=76887; NAME=Caldivirga maquilingensis IC-167; strain=IC-167; AL=Complete Genome; RT=Major
Sequence
MEGLSRIDITFYGRGGQGAVTAAQVLAEAAIHSGLFASAFPEYGAERRGAPVRAYVRVAN
QYLGIREPIEKPDVSVVFDTRLIDVFNITKITKPNGTIVINSSEDYAKQMLSQFNGKVVY
VDAYGISMKYLGKAIVNTPMLGALLRVIGMINIEVVKELIRNTFRGRIGQLNAEAIDEAY
KLARVIP
Download sequence
Identical sequences A8MB51
397948.Cmaq_1863 gi|159042418|ref|YP_001541670.1| WP_012186899.1.60673

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]