SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_012191641.1.4816 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012191641.1.4816
Domain Number 1 Region: 147-211
Classification Level Classification E-value
Superfamily Ligand-binding domain in the NO signalling and Golgi transport 0.000000575
Family MJ1460-like 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_012191641.1.4816
Sequence length 216
Comment hypothetical protein [Herpetosiphon geysericola]; AA=GCF_001306135.1; RF=representative genome; TAX=70996; STAX=70996; NAME=Herpetosiphon geysericola; strain=DSM 7119; AL=Contig; RT=Major
Sequence
MAEERTNTSDELERLFYPNKIARLYLLSLEDVMGRTGVNALLNMAGMKHLVNNYPPNDLK
REFSFFDLATISEATETMFGPRGARGMELRAGRYAFSLGLKEFGPLLGMADLALKLMPMT
MKMKIVLNAVAQTFDRFSDQPSRVEDQKGRFLYYIDKSPVFWGRGNSTPIFYLAQGIIEE
ALTWVTGGHNFKVEQVASPRNGDPYCAFAIDKEPID
Download sequence
Identical sequences A0A0P6XYX0 A9AWJ0
WP_012191641.1.4816 gi|159900630|ref|YP_001546877.1| 316274.Haur_4117

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]