SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_012193148.1.31524 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012193148.1.31524
Domain Number 1 Region: 7-241
Classification Level Classification E-value
Superfamily SAICAR synthase-like 9.48e-75
Family SAICAR synthase 0.00000621
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_012193148.1.31524
Sequence length 245
Comment phosphoribosylaminoimidazolesuccinocarboxamide synthase [Methanococcus maripaludis]; AA=GCF_000018485.1; RF=na; TAX=444158; STAX=39152; NAME=Methanococcus maripaludis C6; strain=C6; AL=Complete Genome; RT=Major
Sequence
MLYDISKITAKEPIYVGKAKSIYTIEENEKEVLVEFRDDITAGNGAKHDVKFGKGYLNTV
ISNELFKVLEKNNVPTHLIEYIEPNHMIAKNVKIIPLEVIVRNIAAGSLCKKYPFEQGQV
LKTAVTQLDYKNDDYGDPMLNNEIAIELGLATEEELVEIKKLALKVNDVLKGFFDEKGII
LVDFKIEVGKTVDGDIVVADEISPDTMRLWDKETKDVLDKDVFRKDLGDVLEKYKIVAER
IGCLK
Download sequence
Identical sequences A9A764
gi|159904743|ref|YP_001548405.1| 444158.MmarC6_0352 WP_012193148.1.31524

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]