SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_012194241.1.31524 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012194241.1.31524
Domain Number 1 Region: 2-103
Classification Level Classification E-value
Superfamily GlnB-like 4.08e-27
Family Divalent ion tolerance proteins CutA (CutA1) 0.0000803
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_012194241.1.31524
Sequence length 104
Comment divalent ion tolerance protein CutA [Methanococcus maripaludis]; AA=GCF_000018485.1; RF=na; TAX=444158; STAX=39152; NAME=Methanococcus maripaludis C6; strain=C6; AL=Complete Genome; RT=Major
Sequence
MGKPTLVYTTFPSLENAKSIVGYLLEKKMIACANLREHESHYLEDNDIVIKTEVGAFLKT
VENRWDILKDMINEIHPLETPVILKINIDDSNEEFENWICNITK
Download sequence
Identical sequences A9AAE8
WP_012194241.1.31524 gi|159905891|ref|YP_001549553.1| 444158.MmarC6_1508

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]