SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_012194351.1.31524 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012194351.1.31524
Domain Number 1 Region: 74-133
Classification Level Classification E-value
Superfamily NfeD domain-like 0.000000000000955
Family NfeD domain-like 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_012194351.1.31524
Sequence length 137
Comment hypothetical protein [Methanococcus maripaludis]; AA=GCF_000018485.1; RF=na; TAX=444158; STAX=39152; NAME=Methanococcus maripaludis C6; strain=C6; AL=Complete Genome; RT=Major
Sequence
MELGYITIIIGMGLILLEAFLSGLNFPVAGVAVLIYGIFLLYAPEFALPSAIIAGLITAY
IMKRFVYKTGLNVKIGAENLIGEHGDLVDEIGENNYGHVIIHGERWQAKSETPIKKGSKV
VVTGIEGVSLLIEESSE
Download sequence
Identical sequences A9AAR3
gi|159906006|ref|YP_001549668.1| 444158.MmarC6_1624 WP_012194351.1.31524

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]