SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_012224548.1.42434 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012224548.1.42434
Domain Number 1 Region: 2-232
Classification Level Classification E-value
Superfamily FAD-linked oxidoreductase 8.63e-33
Family Methylenetetrahydrofolate reductase 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_012224548.1.42434
Sequence length 247
Comment methylenetetrahydrofolate reductase [Gluconacetobacter diazotrophicus]; AA=GCF_000067045.1; RF=na; TAX=272568; STAX=33996; NAME=Gluconacetobacter diazotrophicus PA1 5; strain=PAl 5; AL=Complete Genome; RT=Major
Sequence
MTRISVELIPRDAEALLRDAAEVRQHFPLADTLNVPSLMRFPLRGWDAVPLLRPVLPRIV
PHIRAIDVDPAGPLPGVDVPGLEEVLVVQGDPPADLGHRTFPNSSESVIRRYRREAPHLR
VYAAFDPYRRAPYHELDAVARKKDAGATGFFTQPVFDPRMLDLCMEWLAGEAVFWGLSPV
IGPKSRSYWETTNHVVFPRDFEPTIEANIAFACRAIRTVRDAGGHVYLMPLRVKLERYLA
PIQQELG
Download sequence
Identical sequences A9HEL4
272568.GDI_1306 WP_012224548.1.42434 WP_012224548.1.67455 gi|162147101|ref|YP_001601562.1| gi|162147101|ref|YP_001601562.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]