SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_012231426.1.76171 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012231426.1.76171
Domain Number 1 Region: 2-132
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 4.97e-35
Family Transcriptional regulator Rrf2 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_012231426.1.76171
Sequence length 144
Comment transcriptional regulator [Bartonella tribocorum]; AA=GCF_000689355.1; RF=na; TAX=85701; STAX=85701; NAME=Bartonella tribocorum; strain=BM1374166; AL=Complete Genome; RT=Major
Sequence
MRLTKQTNYALRMLMYCADNQGSLSRVSEIAKAYAVSELFLFKILQPLVQAGFIQTVRGR
NGGVKLAKPATEISVADVLKVTEDNFSLAECFDNAEPTCPLIDFCSLNIALQKALSAFFD
VLSVISLADLQRPSFHNHFKVNKQ
Download sequence
Identical sequences A9IS90
WP_012231426.1.76171 WP_012231426.1.90605 382640.Btr_0871 gi|163868066|ref|YP_001609270.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]