SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_012232148.1.76171 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012232148.1.76171
Domain Number 1 Region: 3-125
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.36e-23
Family FUR-like 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_012232148.1.76171
Sequence length 130
Comment Fur family transcriptional regulator [Bartonella tribocorum]; AA=GCF_000689355.1; RF=na; TAX=85701; STAX=85701; NAME=Bartonella tribocorum; strain=BM1374166; AL=Complete Genome; RT=Major
Sequence
MSSKLTRNQILVLNTLKNAKGPLSAYAILDQLREEGFRAPLQVYRALEKLVQLKCIHRLE
SVNAFMVCLHPEKCQHELTTFIICENCGTVNEIQNQMIVSSLKQMVQAIDFQAHKSTLEV
RGLCKKCATK
Download sequence
Identical sequences A9IWT0
382640.Btr_1745 WP_012232148.1.76171 WP_012232148.1.90605 gi|163868807|ref|YP_001610031.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]