SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_012242781.1.92431 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012242781.1.92431
Domain Number 1 Region: 86-147
Classification Level Classification E-value
Superfamily NfeD domain-like 0.0000000353
Family NfeD domain-like 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_012242781.1.92431
Sequence length 152
Comment hypothetical protein [Acholeplasma laidlawii]; AA=GCF_001729655.1; RF=na; TAX=2148; STAX=2148; NAME=Acholeplasma laidlawii; strain=PG8S; AL=Contig; RT=Major
Sequence
MIEFLAEYAIWFWLLVFVTTIIIEFMTVEFVSIWFALASIPTLIISIFMPTNIGLQMIVF
FLTGFILMILTRPALVKYFKKNIVSTNVDAYVGKSAIVIKEISPLTRGQVDFEHMNWTAI
SSEDIEVGATVRILAIEGNKFIVTKINKEDLN
Download sequence
Identical sequences A0A2G7QJW1 A9NGH0
441768.ACL_0836 ABX81450 gi|162447694|ref|YP_001620826.1| WP_012242781.1.15573 WP_012242781.1.20474 WP_012242781.1.46366 WP_012242781.1.71135 WP_012242781.1.72193 WP_012242781.1.73551 WP_012242781.1.92431

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]