SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_012245424.1.55099 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012245424.1.55099
Domain Number 1 Region: 87-145
Classification Level Classification E-value
Superfamily NfeD domain-like 0.000000196
Family NfeD domain-like 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_012245424.1.55099
Sequence length 166
Comment membrane protease regulatory membrane protein [Renibacterium salmoninarum]; AA=GCF_000018885.1; RF=representative genome; TAX=288705; STAX=1646; NAME=Renibacterium salmoninarum ATCC 33209; strain=ATCC 33209; AL=Complete Genome; RT=Major
Sequence
MFEWLFENGWALWLIIFLALAVIEMLTLDLFFILMSVGALAAVVADLLGAPLWLQVIIFC
IVALAMILFVRPIALRHLHKGPNDLRTNVDRLIGHAAVVIEPVTSDGGRVKIGGDIWSAR
STNGAALAIGNNVEVTAIEGATAIVVAAAITPQSPHAEYPGTPAGA
Download sequence
Identical sequences A9WSG6
288705.RSal33209_2021 WP_012245424.1.55099 gi|163840763|ref|YP_001625168.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]