SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_012247048.1.34756 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012247048.1.34756
Domain Number 1 Region: 126-275
Classification Level Classification E-value
Superfamily Probable bacterial effector-binding domain 3.53e-34
Family Gyrase inhibitory protein GyrI (SbmC, YeeB) 0.0091
Further Details:      
 
Domain Number 2 Region: 63-111
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000000627
Family AraC type transcriptional activator 0.01
Further Details:      
 
Domain Number 3 Region: 11-58
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000224
Family AraC type transcriptional activator 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_012247048.1.34756
Sequence length 276
Comment AraC family transcriptional regulator [Bordetella petrii]; AA=GCF_000067205.1; RF=representative genome; TAX=94624; STAX=94624; NAME=Bordetella petrii; strain=DSM 12804; AL=Complete Genome; RT=Major
Sequence
MKATTRIHYANRLEPVLHWLASHPDAAPDLYHLADLACLSPYHFHRVYRALMGETVNATM
QRMRMHRASVDLAGSRPMPQVARRAGYTSQAAFNRAFGAAFGMPPGRYRHARSRPFNPQE
LGMYPVTIEQFAGASLATLAHQGDYQNIGATFDRLFMLAAGRDLVGPATRSFGVYYDDPA
QVPADRLRSRAGLTLPDGASADPVFEPFALPAARCAVLEYTGPYSEIEAAYNWLFAQWLP
ASGHETLDFPMWEEYVNDPKTTPAAELKTRIYLPLA
Download sequence
Identical sequences A9HVI2
340100.Bpet0019 gi|163854323|ref|YP_001628621.1| WP_012247048.1.34756

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]