SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_012260878.1.99908 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012260878.1.99908
Domain Number 1 Region: 22-104
Classification Level Classification E-value
Superfamily Mechanosensitive channel protein MscS (YggB), transmembrane region 0.0000000000301
Family Mechanosensitive channel protein MscS (YggB), transmembrane region 0.004
Further Details:      
 
Domain Number 2 Region: 106-169
Classification Level Classification E-value
Superfamily Sm-like ribonucleoproteins 0.00000000134
Family Mechanosensitive channel protein MscS (YggB), middle domain 0.0032
Further Details:      
 
Domain Number 3 Region: 171-277
Classification Level Classification E-value
Superfamily Mechanosensitive channel protein MscS (YggB), C-terminal domain 0.00000000353
Family Mechanosensitive channel protein MscS (YggB), C-terminal domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_012260878.1.99908
Sequence length 297
Comment mechanosensitive ion channel protein [Bacillus weihenstephanensis]; AA=GCF_000018825.1; RF=na; TAX=315730; STAX=86662; NAME=Bacillus weihenstephanensis KBAB4; strain=KBAB4; AL=Complete Genome; RT=Major
Sequence
MSLLTYTEEFFNYVREFLLLRFLLFALVLIIISFVINRSIDWFFKKSSFFDEEVEQTIQS
VIRSIFRYIIIISLIIYLISQFVDIKSIIAGAGIAGVVIGFAAQQMLKDVILGFARLADK
EFRVGDFVTFNGTNSGTIEEISVRFMQIREWSGKLLTIPHGEIRTIQNFNKGWMRVIERI
TVSYQEDPTRVKELLEEVCVICNEKLDQSLYRVDDEAVEPFKYVGVTDLNPNLKYVGYEF
CITGLIKPEDYFETSRQVRFELMSIFHKNQVQMPAANMFVNTESLQNIHVGQSLSDS
Download sequence
Identical sequences A9VTZ4
gi|163940054|ref|YP_001644938.1| WP_012260878.1.99908 315730.BcerKBAB4_2085

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]