SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_012261285.1.99908 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012261285.1.99908
Domain Number 1 Region: 4-69
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 2.51e-17
Family Phage repressors 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_012261285.1.99908
Sequence length 242
Comment transcriptional regulator [Bacillus weihenstephanensis]; AA=GCF_000018825.1; RF=na; TAX=315730; STAX=86662; NAME=Bacillus weihenstephanensis KBAB4; strain=KBAB4; AL=Complete Genome; RT=Major
Sequence
MREIHIHKIIADKRKEKGITQEELAAYIGITKASVSKWETGQSYPDITFVPLLASYFNIS
IDELICYTLQMEQEDIKNLYHRLAEAFSEEPFDEVMMECREVTKKYYSCFPLLIQMGLLF
INHHMLTEDMDRRIEILEEAMYLFSRVQGESVDVSLVKEAVSFKATCYLILNRPNEVLQL
LGETIRPNFPEEDLIAQAYQMFGNAEKANEMMQISMYQHLIQLVATIPNYVVVHASNAEK
VE
Download sequence
Identical sequences A9VLW5
gi|163940975|ref|YP_001645859.1| WP_012261285.1.99908 315730.BcerKBAB4_3051

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]