SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_012266788.1.43975 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012266788.1.43975
Domain Number 1 Region: 28-185
Classification Level Classification E-value
Superfamily SMAD/FHA domain 1.45e-17
Family FHA domain 0.0018
Further Details:      
 
Weak hits

Sequence:  WP_012266788.1.43975
Domain Number - Region: 3-26
Classification Level Classification E-value
Superfamily Rubredoxin-like 0.0271
Family Rubredoxin 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_012266788.1.43975
Sequence length 187
Comment hypothetical protein [Microcystis aeruginosa]; AA=GCF_001895325.1; RF=na; TAX=1914535; STAX=1126; NAME=Microcystis aeruginosa CHAOHU 1326; strain=CHAOHU 1326; AL=Scaffold; RT=Major
Sequence
MAIVCKVCGYDQNPQGAEYCDACGAELTPSTPPTPPTPVIPDPIPEPTPMPIPQPIAETI
TLTPEPLPQPITPAITTTARLIAKHPNAPVAEFFIDGFTLIGIFDSDTGPVDVDLEKFPD
NETVSRNHAEIYPDGGTWKIKDLGSLNGVFIKPIGQTRFNARITAPTPLSSGDEIAIAKI
RFLFQTP
Download sequence
Identical sequences B0JR36
gi|166366824|ref|YP_001659097.1| WP_012266788.1.4043 WP_012266788.1.43975 449447.MAE_40830

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]