SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_012270015.1.65540 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012270015.1.65540
Domain Number 1 Region: 57-258
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 3.93e-38
Family Phosphate binding protein-like 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_012270015.1.65540
Sequence length 345
Comment nitrate ABC transporter substrate-binding protein [Pseudomonas putida]; AA=GCF_001886975.1; RF=na; TAX=303; STAX=303; NAME=Pseudomonas putida; strain=PP112420; AL=Complete Genome; RT=Major
Sequence
MKTPLRHLITALGLAFTLSAHAAEPAKPASIRIAVPDLSAGSKASAGGVVDVLRDQQLLE
KEFAKDGIRIDWRFFKGAGPVVNEALANGQADFAYLGDLAAIVGKANGLDTRVLSAGVRG
VKSYLGVVPGSGIKTLHDLKGKRVAVFRGTANQLSFASALASQGLSERELKVINLDFNAA
NAALAAKQIDATWGLSNLLSLRERGLVELPVNSRDLEGAGSTQAVLLGTGDFIRQYPELV
QRLVNAQEQASAWLRDEHNRQAYIDLVASNANWPRSILSDDLAKEDLAHYFDPRLDAGFV
GQLQQGVDLAAKERLIRRGFQVADWIEPRFLDAALKQEQAVQAAR
Download sequence
Identical sequences B0KH26
gi|167031250|ref|YP_001666481.1| 76869.PputGB1_0232 WP_012270015.1.65540 WP_012270015.1.81634

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]