SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_012270707.1.66485 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012270707.1.66485
Domain Number 1 Region: 28-426
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 7.85e-55
Family Phosphate binding protein-like 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_012270707.1.66485
Sequence length 428
Comment sugar ABC transporter substrate-binding protein [Pseudomonas putida]; AA=GCF_001750465.1; RF=na; TAX=303; STAX=303; NAME=Pseudomonas putida; strain=IAC-RBcr5; AL=Contig; RT=Major
Sequence
MNSTLRLAAAISLASLLPLSAQAAEPKGSVEVVHWWTSGGEKAAVDVLKAQVEKDGFTWK
DGAVAGGGGATAMTVLKSRAVAGNPPGVAQIKGPDIQDWAATGLLDGEVLKDVAKQEQWD
TLLDKKVADNVKYDGDYVAVPVNIHRTNWLWINPEVFKKAGIDKAPATLDEFYAAADKLK
AAGFIPLAHGGQPWQDSTVFESVVLSVMGAQGYKKAMVDLDNAALTGPDMVKALAELKKV
ANYMDPDGKGQDWNLEAAKVINGKAGMQIMGDWAKSEWTLAKKTAGKDYQCVPFPGTDKA
FLYNIDSLVVFKQNNAGTSAGQQDIARKVMGEDFQKVFSTNKGSIPVRNDMLADMAKYGF
DACAQRSASDFLADAKNGGLQPSMAHNMATTLAVQGAFFDVVTNYINDPKADPADAAKKL
AAAIKAAR
Download sequence
Identical sequences B0KRC9
WP_012270707.1.65540 WP_012270707.1.66485 WP_012270707.1.81634 76869.PputGB1_1013 gi|167032028|ref|YP_001667259.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]