SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_012271214.1.65540 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012271214.1.65540
Domain Number 1 Region: 7-179
Classification Level Classification E-value
Superfamily Transmembrane di-heme cytochromes 4.39e-29
Family Formate dehydrogenase N, cytochrome (gamma) subunit 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_012271214.1.65540
Sequence length 181
Comment MULTISPECIES: cytochrome b [Pseudomonas]; AA=GCF_001886975.1; RF=na; TAX=303; STAX=303; NAME=Pseudomonas putida; strain=PP112420; AL=Complete Genome; RT=Major
Sequence
MVSSTPATHYARLSIALHWLMLVLLAAVYALIELRGLFPKDSAERNLMKDLHFMLGLSVF
VLVWLRLAMRLSRPTPPIVPKPPAWQTGLAHLMHLALYLLMIGLPLAGWLILSAADKPVP
FFGLELPHLIGPNPDQAKFIKGWHERIGSWGYWLIGLHALAGLYHHYVQRDNTLLRMLPY
K
Download sequence
Identical sequences B0KFA7
gi|167032552|ref|YP_001667783.1| WP_012271214.1.13892 WP_012271214.1.54657 WP_012271214.1.65540 WP_012271214.1.66485 WP_012271214.1.81634 76869.PputGB1_1542

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]