SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_012271861.1.65540 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012271861.1.65540
Domain Number 1 Region: 215-317
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 8.39e-30
Family 2Fe-2S ferredoxin domains from multidomain proteins 0.012
Further Details:      
 
Domain Number 2 Region: 98-226
Classification Level Classification E-value
Superfamily Ferredoxin reductase-like, C-terminal NADP-linked domain 7.46e-28
Family Aromatic dioxygenase reductase-like 0.0048
Further Details:      
 
Domain Number 3 Region: 4-100
Classification Level Classification E-value
Superfamily Riboflavin synthase domain-like 1.65e-22
Family Ferredoxin reductase FAD-binding domain-like 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_012271861.1.65540
Sequence length 319
Comment MULTISPECIES: ferredoxin [Pseudomonas]; AA=GCF_001886975.1; RF=na; TAX=303; STAX=303; NAME=Pseudomonas putida; strain=PP112420; AL=Complete Genome; RT=Major
Sequence
MNEELLNVVVRKREIQGADVVVLDLGRADGAALPAFEAGAHVDIHVAPGLVRQYSLCSDP
ADVTVYRLGVLKDPASRGGSVGVHEALMEGREVQISAPRNLFPLAAGAARSILLGGGIGI
TPMIAMAHALHQQGADFELHYCGRSRSRSAFLEALADAPFAARVVTHFDDEEATQRLNLA
DVLGAGMPGTHLYTCGPSGFMDWVIAGARQQGYAEEHIHKEYFQVEVDATGQGFEVVAAR
SNKTVQVAEGQTILDALAQVGIRIDISCEQGVCGTCMCEVLEGEPDHRDVYLTDEEKAAN
DQILVCCSRAKSNKLVLDI
Download sequence
Identical sequences B0KNJ0
gi|167033218|ref|YP_001668449.1| WP_012271861.1.54657 WP_012271861.1.65540 WP_012271861.1.66485 WP_012271861.1.81634 76869.PputGB1_2212

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]