SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_012271943.1.13892 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012271943.1.13892
Domain Number 1 Region: 82-147
Classification Level Classification E-value
Superfamily CO dehydrogenase ISP C-domain like 6.54e-25
Family CO dehydrogenase ISP C-domain like 0.00084
Further Details:      
 
Domain Number 2 Region: 2-75
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 3.01e-24
Family 2Fe-2S ferredoxin domains from multidomain proteins 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_012271943.1.13892
Sequence length 151
Comment MULTISPECIES: (2Fe-2S)-binding protein [Pseudomonas]; AA=GCF_001320565.1; RF=na; TAX=1661047; STAX=1661047; NAME=Pseudomonas sp. NBRC 111132; strain=NBRC 111132; AL=Contig; RT=Major
Sequence
MELRINQKTYQVEADADTPLLWVIRDDLGLTGTKYGCGLAQCGACSVLVDGNVVRACVTP
VAGVVGREVTTIEAIEADAVGKRVVAAWVEHQVAQCGYCQSGQVMAATALLKHTPKPSDA
QIDAAMVNLCRCGTYNAIHAAVHDLAQGEQA
Download sequence
Identical sequences A0A1Y3LEB1 B0KNS4
gi|167033302|ref|YP_001668533.1| WP_012271943.1.13892 WP_012271943.1.18387 WP_012271943.1.54657 WP_012271943.1.65540 WP_012271943.1.66485 WP_012271943.1.81634 76869.PputGB1_2296

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]