SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_012272323.1.54657 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012272323.1.54657
Domain Number 1 Region: 204-333
Classification Level Classification E-value
Superfamily Ferredoxin reductase-like, C-terminal NADP-linked domain 1.02e-35
Family Aromatic dioxygenase reductase-like 0.0000624
Further Details:      
 
Domain Number 2 Region: 1-99
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 1.57e-28
Family 2Fe-2S ferredoxin domains from multidomain proteins 0.0011
Further Details:      
 
Domain Number 3 Region: 76-205
Classification Level Classification E-value
Superfamily Riboflavin synthase domain-like 1.87e-24
Family Ferredoxin reductase FAD-binding domain-like 0.00029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_012272323.1.54657
Sequence length 336
Comment MULTISPECIES: NADH oxidase [Pseudomonas]; AA=GCF_001320885.1; RF=na; TAX=1661055; STAX=1661055; NAME=Pseudomonas sp. NBRC 111140; strain=NBRC 111140; AL=Contig; RT=Major
Sequence
MSYQIALNFEDGVTRFIEASGHETVADAAYRQGINIPLDCRDGACGTCKCKAESGRYDLG
DNFIEDALSEDEIAEGYVLTCQMRAESDCVIRIPASSQLCKTEQASFEAAISDVRQLSAS
TIALSIKGEALSRLAFLPGQYVNLKVPGSEQSRAYSFSSLQKDGEVSFLIRNVPGGLMSS
FLTNLAKAGDNMSLAGPLGSFYLRPIQRPLLLLAGGTGLAPFTAMLERIAEQGSEHPLHL
IYGVTNDFDLVELDRLQALASRIPNFTYSACVANPDSQYPQKGYVTQHIEPRHLNDGDVD
VYLCGPPPMVEAVSQYVREQGITPANFYYEKFAAAA
Download sequence
Identical sequences B0KT96
76869.PputGB1_2686 gi|167033688|ref|YP_001668919.1| WP_012272323.1.13892 WP_012272323.1.54657 WP_012272323.1.65540 WP_012272323.1.66485 WP_012272323.1.81634

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]