SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_012273897.1.65540 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012273897.1.65540
Domain Number 1 Region: 6-273
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 3.99e-60
Family Phosphate binding protein-like 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_012273897.1.65540
Sequence length 305
Comment MULTISPECIES: amino acid ABC transporter substrate-binding protein [Pseudomonas]; AA=GCF_001886975.1; RF=na; TAX=303; STAX=303; NAME=Pseudomonas putida; strain=PP112420; AL=Complete Genome; RT=Major
Sequence
MRIVRQLLGAAIAAAVIASPAMAEELTGTLKKIKDSGTITLGHRDSSIPFSYLAGKPEPV
GYSHDIQLAVVDALKKQLGTDIKVKYNLVTSQTRIPLVQNGTVDLECGSTTNNVERQQQV
GFSVGIFEVGTRLLTKVKDGQPAYKDFPDLAGKNVVTTAGTTSERILKAMNADKQMKMNV
ISAKDHGEAFNMLESGRAVAFMMDDALLAGEMAKARKPSDWVITGTPQSYEIYGCMVRKE
DAAFKKAVDDAIVGYFKSGEVNKSYEKWFMQPIPPKGLNLQFQMSDELKKLIAEPTDKAA
DEKKS
Download sequence
Identical sequences B0KUG4
WP_012273897.1.13892 WP_012273897.1.54657 WP_012273897.1.65540 WP_012273897.1.66485 WP_012273897.1.81634 76869.PputGB1_4341 gi|167035334|ref|YP_001670565.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]