SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_012299800.1.13751 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012299800.1.13751
Domain Number 1 Region: 6-80
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 4.35e-21
Family GntR-like transcriptional regulators 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_012299800.1.13751
Sequence length 116
Comment GntR family transcriptional regulator [Clavibacter michiganensis]; AA=GCF_002240585.1; RF=na; TAX=31964; STAX=28447; NAME=Clavibacter michiganensis subsp. sepedonicus; strain=CFIA-CsR14; AL=Contig; RT=Major
Sequence
MLITVDPTAKTSLAEQVATQIRYAIARGEVASGERLPSARDLAASIDVNMHTVLRAYASL
QADGLIELRRGRGATVIRSGNASFDRLRTLVEELREQADTLGVPMDDLFTMIKGAR
Download sequence
Identical sequences B0RHQ3
WP_012299800.1.12855 WP_012299800.1.13751 WP_012299800.1.33835 gi|170782855|ref|YP_001711189.1| 31964.CMS_2532

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]