SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_012300280.1.13751 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012300280.1.13751
Domain Number 1 Region: 3-123
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 9.66e-29
Family FUR-like 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_012300280.1.13751
Sequence length 147
Comment transcriptional repressor [Clavibacter michiganensis]; AA=GCF_002240585.1; RF=na; TAX=31964; STAX=28447; NAME=Clavibacter michiganensis subsp. sepedonicus; strain=CFIA-CsR14; AL=Contig; RT=Major
Sequence
MKRNTWQREAVRQALDASTEFVSAQRLHARLHDAGSPIGLATVYRALGDLAAEGDADSLQ
SPDGEALYRTCASGGHHHHLICRVCGKTVEIAADEVESWAHDVAARNGFTAPSHVVDVFG
LCAECTRRAAEAADGPTAGVAEAPASA
Download sequence
Identical sequences B0RDL2
gi|170783361|ref|YP_001711695.1| 31964.CMS_3073 WP_012300280.1.12855 WP_012300280.1.13751 WP_012300280.1.33835

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]