SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_012302891.1.36146 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012302891.1.36146
Domain Number 1 Region: 1-113
Classification Level Classification E-value
Superfamily AF1862-like 6.02e-28
Family Cas Cmr5-like 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_012302891.1.36146
Sequence length 125
Comment type III-B CRISPR module-associated protein Cmr5 [Candidatus Desulforudis audaxviator]; AA=GCF_000018425.1; RF=na; TAX=477974; STAX=471827; NAME=Candidatus Desulforudis audaxviator MP104C; strain=MP104C; AL=Complete Genome; RT=Major
Sequence
MQTRNQEYAAKIFEQVMQVRDELGKDGSNNYGSLAHRLPVFVRTAGLAQALAFVEARDGA
AGRKLLRDIAAVVNEEELLARSRTAELPEYMLLTRNVLAALAWYKRFAQSVLGVEAGADR
EGVGE
Download sequence
Identical sequences B1I5K6
477974.Daud_1819 WP_012302891.1.36146 gi|169831965|ref|YP_001717947.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]