SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_012305078.1.75472 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012305078.1.75472
Domain Number 1 Region: 5-82,174-352
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 1.3e-61
Family Bacterial dinuclear zinc exopeptidases 0.0000309
Further Details:      
 
Domain Number 2 Region: 72-182
Classification Level Classification E-value
Superfamily Aminopeptidase/glucanase lid domain 2.14e-24
Family Aminopeptidase/glucanase lid domain 0.00055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_012305078.1.75472
Sequence length 358
Comment glutamyl aminopeptidase [Leuconostoc citreum]; AA=GCF_000026405.1; RF=representative genome; TAX=349519; STAX=33964; NAME=Leuconostoc citreum KM20; strain=KM20; AL=Complete Genome; RT=Major
Sequence
MNDKTWARIKKYTEHQGTSGQEHLVRQALRQDMQPLVDEIHQDGLGGIFGVKNNKQIDAP
RVMFAAHMDEVGFIVTDILPTGTFKVATIGGWNPVVISSQRFTLFTSKGTYPVVSSSVSP
HLLRGTGHAPQLPTIDDILFDGGFVDHDEALAYGVRPGDFIVPEVKTILTANKKRVISKA
WDNRFGVVTILEALEALVNEPTPNTLIMGANVQEEVGLRGAHGAVNLLRPDIFFAVDSSA
ADDNVESQGHQGVLDQGTLLRVFDPTVVTPLRLREFLLSVAEDNHIPYQYFVSKGGTDAA
AAQTARNGIPSVALGVASRYIHTHQTVWSIADFEAAKAFVIAIAKSLDNTNLQTIIGD
Download sequence
Identical sequences B1MXR8
349519.LCK_00487 gi|170016845|ref|YP_001727764.1| WP_012305078.1.75472

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]