SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_012310495.1.32102 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012310495.1.32102
Domain Number 1 Region: 1-210
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 3.97e-58
Family PP-loop ATPase 0.0000228
Further Details:      
 
Domain Number 2 Region: 324-387
Classification Level Classification E-value
Superfamily PheT/TilS domain 8.63e-16
Family tRNA-Ile-lysidine synthetase, TilS, C-terminal domain 0.014
Further Details:      
 
Weak hits

Sequence:  WP_012310495.1.32102
Domain Number - Region: 172-321
Classification Level Classification E-value
Superfamily beta and beta-prime subunits of DNA dependent RNA-polymerase 0.0915
Family RNA-polymerase beta-prime 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_012310495.1.32102
Sequence length 414
Comment tRNA(Ile)-lysidine synthetase [Thermotoga sp. RQ2]; AA=GCF_000019625.1; RF=na; TAX=126740; STAX=126740; NAME=Thermotoga sp. RQ2; strain=RQ2; AL=Complete Genome; RT=Major
Sequence
MLEEGEHVLVAVSGGIDSMTLLYVLRKFSPLLKIKITAAHLDHRIRESSRRDREFVERIC
RQWNIPVETSEVDVPSLWKDSGKTLEEIAREVRYDFLKRTAKKVGASKIALAHHKNDLLE
TVVHRLIRGTGPLGLACISPKREEFIRPFLVFKRSEIEEYAREKGVPYVVDETNYDVKYT
RNFIRHRIVPLMKELNPTVEDAVYRLVSVTHLLRNFVERTVQDFVERNVYFYKDYAVFVE
PEDLFLFLEVTRWVLKEMYGRVPEYEKLIGTLKSKRVEFWSGIFVERSFGYVAVGKTVFK
KKYRVEVKGDMLEMEGFKIRVVNNRNDMKFWVRNRKEGDRIIVNGRERKLKDVFIEKKVP
TFYRDRVPLLVDEEDRVLWVPGIARSDFLPEDVVVELLEYPVGYVKGGTYFEQV
Download sequence
Identical sequences B1L8R5
gi|170288158|ref|YP_001738396.1| 126740.TRQ2_0357 WP_012310495.1.32102

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]