SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_012333087.1.41957 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012333087.1.41957
Domain Number 1 Region: 5-126
Classification Level Classification E-value
Superfamily YjgF-like 1.73e-36
Family YjgF/L-PSP 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_012333087.1.41957
Sequence length 126
Comment MULTISPECIES: RidA family protein [Methylobacterium]; AA=GCF_000019365.1; RF=na; TAX=426117; STAX=426117; NAME=Methylobacterium sp. 4-46; strain=4-46; AL=Complete Genome; RT=Major
Sequence
MRGRIDGGSPFEKAYGYSRAVVEGGFVFVSGTTGYDYAAMTMPEDAAAQAEACWRTIAAV
LEQAGASLERVVRATYYVTDRAEAEAVLAVCGRVMGAVRPAATLVVVAGLLRPEMKVEIE
VTALLP
Download sequence
Identical sequences B0UQK1
gi|170741466|ref|YP_001770121.1| 426117.M446_3282 WP_012333087.1.13143 WP_012333087.1.41957

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]