SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_012346404.1.27902 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012346404.1.27902
Domain Number 1 Region: 193-265
Classification Level Classification E-value
Superfamily C-terminal effector domain of the bipartite response regulators 5.44e-18
Family GerE-like (LuxR/UhpA family of transcriptional regulators) 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_012346404.1.27902
Sequence length 267
Comment helix-turn-helix transcriptional regulator [Leptothrix cholodnii]; AA=GCF_000019785.1; RF=representative genome; TAX=395495; STAX=34029; NAME=Leptothrix cholodnii SP-6; strain=SP-6; AL=Complete Genome; RT=Major
Sequence
MPQPQSVERVPVEPEVSLQPQDIEALALNLDASLNVHTRSHFFTWTQGLLQGLIHHEALI
CVLRCPESATWRVDSFSTRVADSTVFAAPLLRDIALVPRLVDAWKGAHHLPIVLPARRDG
VLGSGAWVAELERIAATRLAVHGCHDIDGDANCLFLLACQGDSPDPRELCLLRLVVPFLR
EAWVRSQMIGGRHDDLPAPHGHAVITVREQEILKWIYLGKSNSEIGQILGISALTVKNHV
QKMLHKLNVVNRAQAVGRAIEAHLIQI
Download sequence
Identical sequences B1Y715
gi|171058058|ref|YP_001790407.1| WP_012346404.1.27902 395495.Lcho_1374

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]