SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_012348024.1.27902 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012348024.1.27902
Domain Number 1 Region: 27-353
Classification Level Classification E-value
Superfamily Metallo-dependent phosphatases 9.57e-67
Family 5'-nucleotidase (syn. UDP-sugar hydrolase), N-terminal domain 0.00089
Further Details:      
 
Domain Number 2 Region: 358-556
Classification Level Classification E-value
Superfamily 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain 5.36e-49
Family 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain 0.0000632
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_012348024.1.27902
Sequence length 557
Comment multifunctional 2',3'-cyclic-nucleotide 2'-phosphodiesterase/5'-nucleotidase/3'-nucleotidase [Leptothrix cholodnii]; AA=GCF_000019785.1; RF=representative genome; TAX=395495; STAX=34029; NAME=Leptothrix cholodnii SP-6; strain=SP-6; AL=Complete Genome; RT=Major
Sequence
MRITRLICPPLIAALAALSGCGLFGPREAPPVAVKVLAINDFHGNLKPPLGGVRIRDPQD
AGKTVSVPAGGAEHLASALREARAKNPNHIFVAAGDLVGASPLLSALFHDEPTIEALGLM
GLEASAVGNHEFDRGAAELLRQQNGGCHPKDGCRGPQDFRGARFQYLAASTIDTRTGRTL
LPAYHVKRFEGIPVAFVGLTLAGTPRIVTPAGVAGLAFRDEAQTVNALVPQLRAQGIEAI
VVLIHEGGFPSGDHNECPGISGPIVGIVERLDPAVDLVVSGHTHRAYNCRIGGRLVTSAD
KYGTVLTEIDLQLDPRSGDVLQARADNLIVRTDRYARDAEQSRLIARYETLAAPLAGRVV
GYMSGRLTREENAAGESVIGQVVADAQLMATEHPLSGGAQIALMNPGGLRADLAAGDGGV
VRYEDIFAVQPFYNNLVTLSLTGAQLRQLLEQQWLDQPRPRILQVSRGFSYSWDASRPPG
QRVRADSLRLNGQPIGADTRYRVSVNSFLASGGDGFSVFRQGLEPVTGMMDVDAFEAYFR
SHERLDVRHDERIRRLP
Download sequence
Identical sequences B1XZA3
395495.Lcho_3013 WP_012348024.1.27902 gi|171059689|ref|YP_001792038.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]