SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_012349134.1.27902 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012349134.1.27902
Domain Number 1 Region: 155-305
Classification Level Classification E-value
Superfamily TPR-like 2.02e-23
Family Tetratricopeptide repeat (TPR) 0.068
Further Details:      
 
Domain Number 2 Region: 64-151
Classification Level Classification E-value
Superfamily C-terminal effector domain of the bipartite response regulators 0.00000000000482
Family PhoB-like 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_012349134.1.27902
Sequence length 309
Comment SARP family transcriptional regulator [Leptothrix cholodnii]; AA=GCF_000019785.1; RF=representative genome; TAX=395495; STAX=34029; NAME=Leptothrix cholodnii SP-6; strain=SP-6; AL=Complete Genome; RT=Major
Sequence
MHTVVTAPATFSSALQDLPFAAGAAGQPHHQPELRPPPGGFVPRVVGYRDQTALAGTEAG
PTLTVQMLDGFQVWIGADPVTGLPQGKPRSLLKLLLLQRRRPLSRARLCALFWPDADAAS
ARNSLNVTLHRLRRALGHASLVRHGDAGYQLVAAGDVWLDTEQFLLHAEMGQLEDAQGRS
AGAIHQYEAALAIYRSDLLDEGDSDRALAAQAQALRDRLNQTLERLAVLREQAADWHGCL
RAALRHLGLDECNEAAHRRLMRCYARLGQPQLAERQYRACVTVLRLQLGLSPSDDTTALY
RRIAARTGD
Download sequence
Identical sequences B1XXS2
395495.Lcho_4139 WP_012349134.1.27902 gi|171060807|ref|YP_001793156.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]