SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_012351531.1.63293 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012351531.1.63293
Domain Number 1 Region: 4-275
Classification Level Classification E-value
Superfamily FAD-linked oxidoreductase 1.08e-101
Family Methylenetetrahydrofolate reductase 0.000000606
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_012351531.1.63293
Sequence length 276
Comment methylenetetrahydrofolate reductase [NAD(P)H] [Cupriavidus taiwanensis]; AA=GCF_000472465.1; RF=na; TAX=1040978; STAX=164546; NAME=Cupriavidus taiwanensis STM 6018; strain=STM 6018; AL=Contig; RT=Major
Sequence
MQDRYFSFEFFPPKTAEGTEKLRNTRAQLAPLKPKYISVTFGAGGTTQQGTLDAVLEIQR
DGIEAAPHLSCVGSSRESIRAILQQYRDGGIRHIVALRGDMPSGMGEIGEFRYANELVEF
IRAETGDWFNIEVAAYPEYHPQAKSPRHDLDNFVRKVKAGADSAITQYFYNADAYFRFVD
DVRALGVEVPIVPGIMPITNYSQLMRFSEMCGAEVPRWVAKRLESFGDDRESIRAFGLDV
VTALCERLLAAGVPGLHFYTLNAAGATKAIWQRLKL
Download sequence
Identical sequences B2AGG4
164546.RALTA_A0190 WP_012351531.1.21467 WP_012351531.1.63293 gi|188590985|ref|YP_001795585.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]