SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_012354272.1.21467 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012354272.1.21467
Domain Number 1 Region: 652-1113
Classification Level Classification E-value
Superfamily ALDH-like 6.81e-130
Family ALDH-like 0.000000325
Further Details:      
 
Domain Number 2 Region: 262-618
Classification Level Classification E-value
Superfamily FAD-linked oxidoreductase 1.41e-120
Family Proline dehydrohenase domain of bifunctional PutA protein 0.0000000000278
Further Details:      
 
Domain Number 3 Region: 88-261
Classification Level Classification E-value
Superfamily N-terminal domain of bifunctional PutA protein 2.22e-65
Family N-terminal domain of bifunctional PutA protein 0.000000149
Further Details:      
 
Domain Number 4 Region: 3-45
Classification Level Classification E-value
Superfamily Ribbon-helix-helix 0.00000000133
Family PutA pre-N-terminal region-like 0.00079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_012354272.1.21467
Sequence length 1327
Comment trifunctional transcriptional regulator/proline dehydrogenase/L-glutamate gamma-semialdehyde dehydrogenase [Cupriavidus taiwanensis]; AA=GCF_000069785.1; RF=na; TAX=977880; STAX=164546; NAME=Cupriavidus taiwanensis LMG 19424; strain=LMG19424; AL=Chromosome; RT=Major
Sequence
MATTTLGVKLDDASRDRLKRVAQSIDRTPHWLIKQAIFSYLEQIERGHLPFDAGAAGTEG
EGSDGTEMVHGDAAPQPFLEFAQSIQPQSVLRAAITSAYRRPETDCVPVLLEQARLPQQQ
ADAAIKMAKALATRLREQKVGTGREGLVQGLIQEFSLSSQEGVALMCLAEALLRIPDKAT
RDALIRDKISGANWQSHLGQSPSLFVNAATWGLLLTGKLVATHTESGLTKALTRIIGKGG
EPLIRKGVDMAMRLMGEQFVTGETISEALANARKYEAQGFRYSYDMLGEAAMTEADAARY
LASYEQAIHAIGQASRGRGIYEGPGISIKLSALHPRYSRAQHERVIGELYGRLKSLTLLA
RQYDIGINIDAEEADRLEISLDLLERLCFEPELAGWNGIGFVVQGYQKRCPFVIDYLIDL
ARRSRHRLMIRLVKGAYWDSEIKRAQVEGLEGYPVYTRKVYTDVSYIACARKLLSVPDAI
YPQFATHNAHTLSAIYQIAGHSYYPGQYEFQCLHGMGEPLYDQVVGPTADGKFNRPCRIY
APVGTHETLLAYLVRRLLENGANTSFVNRIADDTISLDALVADPVAVVEAMHRDEGVLGL
PHPRIPSPRALYGKSRPNSAGIDLANEHRLASLSSALLAGTGERLAAEPMLGAEVARAAD
AITTPVLNPADHRDVVGHVTEASQADVDAALQAAVQAAPIWQATPPDVRAAALERAADLM
EAQMQSLMGIIMREAGKTFSNAIAEVREAVDFLRYYAAEVRRGFDNETHRPLGPVVCISP
WNFPLAIFTGQVAAALAAGNPVLAKPAEQTPLIAAAAVKLLREAGVPAGAVQLLPGRGET
VGAALVGDARVKGVMFTGSTEVARILQRNVAGRLDAAGRPIPLIAETGGQNAMIVDSSAL
AEQVVGDVVNSAFDSAGQRCSALRVLCLQDDVADRVLEMLKGAMQELNMANPDRLSTDVG
PVIDEDARAGIVRHIDAMRAKGRRVHQADPNAAQGASCRHGTFVPPTLIELDSIEELKRE
VFGPVLHVVRFPRAGLDTMVSQINGTGYGLTLGIHTRIDETISFIVSRARVGNLYVNRNI
VGAVVGVQPFGGEALSGTGPKAGGPLYLHRLLSVCPQDAVARSVRAADVNAGAGGAQTVG
PDDDAVRAAEAFREWARRELPEVAAACERFAEASASGLAVTLAGPTGERNTYTLLARERV
LCLAAQEADLALQLGAVLTVGAEAVWPESPVGRGLFARLPKGVQSRVRMVADWTAADTAI
DAVLHHGDSDQLRTVCEQVAARPGAIIGVQGLAQGERNIALDRLLIERSLSVNTAAAGGN
ASLMTIG
Download sequence
Identical sequences B3R7K9
WP_012354272.1.21467 WP_012354272.1.63293 gi|194291160|ref|YP_002007067.1| 164546.RALTA_A3086

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]