SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_012354636.1.21467 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012354636.1.21467
Domain Number 1 Region: 95-128
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.000000125
Family Lrp/AsnC-like transcriptional regulator N-terminal domain 0.091
Further Details:      
 
Weak hits

Sequence:  WP_012354636.1.21467
Domain Number - Region: 33-70
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 0.0373
Family Duplicated SiR/NiR-like domains 1 and 3 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_012354636.1.21467
Sequence length 442
Comment DNA-binding protein [Cupriavidus taiwanensis]; AA=GCF_000069785.1; RF=na; TAX=977880; STAX=164546; NAME=Cupriavidus taiwanensis LMG 19424; strain=LMG19424; AL=Chromosome; RT=Major
Sequence
MTCSFDGLPIARRTTKCGDASHAPKPVAAEGLQPNAARLDAGRLPERILRAIALVYESDG
LRTLHITNRQVLATLVRFALNQKDPSALAFIKKATIAQHLGMSEATVYRALGALEDAGLI
KRERQRRTRAQLEVVGRIGFSSKLLRCIGITSLQVQSTIHVPTRSDESGASTCLAPVNGV
NKTMQSSTKKHPGPGSFLRIDGRAVPMDLAPLVRDQALKMSALFLLMKLARTTGHRLSDV
VSAAGNALRPLRGRELFAYLKSLLEMPVDYGHIVRTRKLREDAGRAAEARATRERQQIAE
LVARYRGKRVSAPDGSTYEVDSASIVFIDRNGRRSSVGHDQARAWLFEMDRVACGSSSGP
IQLTQPGQPSSVVARAAIETIRGLVHGRNASQELDCFGLGISKELATPRTGYGMLRKSAQ
ESKTCDSDSVDQREEIRCVMRD
Download sequence
Identical sequences B2AKE6
gi|188591571|ref|YP_001796170.1| WP_012354636.1.21467 WP_012354636.1.63293 WP_012354636.1.84351 gi|188591571|ref|YP_001796170.1|NC_010529 164546.pRALTA_0311

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]