SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_012398051.1.5541 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012398051.1.5541
Domain Number 1 Region: 3-303
Classification Level Classification E-value
Superfamily ATP synthase (F1-ATPase), gamma subunit 4.84e-74
Family ATP synthase (F1-ATPase), gamma subunit 0.0000691
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_012398051.1.5541
Sequence length 303
Comment ATP synthase subunit gamma [Kocuria rhizophila]; AA=GCF_000010285.1; RF=representative genome; TAX=378753; STAX=72000; NAME=Kocuria rhizophila DC2201; strain=DC2201 (= NBRC 103217); AL=Complete Genome; RT=Major
Sequence
MGAQIRVYRQKIASTSSMKKIFKAMEMIATSRINKSRQALEGAYPYANALTRAASQIATQ
HNISHPLTTVPDQVRRSAVMVFTSDRGLAGSYSSNVLKRTEELLELLRSQGKEARVYLVG
RKAKAYFDFRHREYDEFWTGNTDNASTERAEELTERLMHDISAPHEDGGVDEVLLVYTQF
KSMVTQEPRVLRLLPLEIADANDLGDDVSERFEDLREHASHFEFEPNPEEVFNEILPRYV
RARVYSALCHAASSELASRQRAMKAAGDNATELIKKYTRLMNNARQAEITTELTEIVSGA
EAL
Download sequence
Identical sequences B2GLY9
WP_012398051.1.5541 WP_012398051.1.84478 gi|184200629|ref|YP_001854836.1| 378753.KRH_09830

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]