SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_012404400.1.55900 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012404400.1.55900
Domain Number 1 Region: 5-116,163-335
Classification Level Classification E-value
Superfamily Acetamidase/Formamidase-like 1.57e-87
Family Acetamidase/Formamidase-like 0.000084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_012404400.1.55900
Sequence length 343
Comment formamidase [Paraburkholderia phymatum]; AA=GCF_000020045.1; RF=representative genome; TAX=391038; STAX=148447; NAME=Paraburkholderia phymatum STM815; strain=STM815; AL=Complete Genome; RT=Major
Sequence
MLYDLPAIQKNVHWGYFDATLAPALIVESGDFIRAEAITHHAGDAPDLMMDDKVRALYDT
IPESDRAPGVHLMTGPIFVNDARPGDLLEVRYLHMTPRFNYGSNLAAHWGHLFTDFEKER
VTIYELDQASNTAHALYAYDYPGKYLVPGKRSEIRDCCREVALDGIRVPVRPHLGTAGVA
PDVAGRVSTVPPGAHGGNIDNWRIGAGSTMYYPVAVDGGLFSIGDPHVSQGDGEISGTAI
EASLNVMFQIVLRRDFAFPSPLLETPDFWIVHGFDEDLNIATKNASRDMLLLLTEQQGLS
RDDAYSLMSVAADFSVTQVVDGRQGIHCKIPRSVFPPKKKPRV
Download sequence
Identical sequences B2JMA1
391038.Bphy_5149 WP_012404400.1.55900 gi|186473940|ref|YP_001861282.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]