SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_012407622.1.44837 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012407622.1.44837
Domain Number 1 Region: 10-72
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 0.0000000000174
Family SinR domain-like 0.049
Further Details:      
 
Weak hits

Sequence:  WP_012407622.1.44837
Domain Number - Region: 78-127
Classification Level Classification E-value
Superfamily DnaJ/Hsp40 cysteine-rich domain 0.0251
Family DnaJ/Hsp40 cysteine-rich domain 0.01
Further Details:      
 
Domain Number - Region: 122-144
Classification Level Classification E-value
Superfamily Rubredoxin-like 0.0447
Family Rubredoxin 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_012407622.1.44837
Sequence length 155
Comment XRE family transcriptional regulator [Nostoc punctiforme]; AA=GCF_000020025.1; RF=representative genome; TAX=63737; STAX=272131; NAME=Nostoc punctiforme PCC 73102; strain=ATCC 29133; PCC 73102; AL=Complete Genome; RT=Major
Sequence
MDTFKTPNSDESLASYVSRVRKKLNLTQSELADAAGIHGRSVGKIERGLTLKINRRTLQG
LAIALGVPQEYFDAVIKGEEVSQVRGVKFCPQCWNPGAAVDPMWSHIKAKFCYLCGTPIR
ANCANCGELVLSLRHRFCPICGCAYKTPVKTAKIQ
Download sequence
Identical sequences B2IU29
WP_012407622.1.44837 63737.Npun_AR015 63737.Npun_BF081 63737.Npun_CR025 63737.Npun_DR049 63737.Npun_F0863 gi|186681347|ref|YP_001864543.1| gi|186686686|ref|YP_001869880.1| gi|186686753|ref|YP_001869946.1| gi|186687045|ref|YP_001870434.1| gi|186687122|ref|YP_001870265.1| gi|186686686|ref|YP_001869880.1|NC_010630 gi|186686753|ref|YP_001869946.1|NC_010631 gi|186687045|ref|YP_001870434.1|NC_010633 gi|186687122|ref|YP_001870265.1|NC_010632

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]