SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_012411851.1.44837 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012411851.1.44837
Domain Number 1 Region: 65-358
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 2.93e-90
Family Thermolysin-like 0.0000012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_012411851.1.44837
Sequence length 359
Comment peptidase M4 family protein [Nostoc punctiforme]; AA=GCF_000020025.1; RF=representative genome; TAX=63737; STAX=272131; NAME=Nostoc punctiforme PCC 73102; strain=ATCC 29133; PCC 73102; AL=Complete Genome; RT=Major
Sequence
MARNKKKSAGFKYEHPLVSRCPICCIIPPHILEHVVVNGNPQQRNWAFRTLNVSAQFRGR
RDVIGTVSFAPSPGEKRRTIYDAKYGQQLPGTLVRGEGDPPSSDIAVNEAYDAAGATYDL
FYEIFDRNSVDDKGLRLDSTVHYGVKYDNAFWNGDQMVYGDGDGEMFQRFTTSIDVIGHE
LTHGITQYEAGLQYYGEPGALNESFSDVFGSLVKQKSKNQTAQEADWLIGEGLLVPTVKG
VALRSMKAPGTAYDDPVMGKDPQPAHVKDKYTGTDDNGGVHINSGIPNHAFYLAAVSIGG
YAWEKAGKIWYIALRDRLKAKADFKKAASVTIQIAGELYGNGSDDQKAVQDAWQKVGVI
Download sequence
Identical sequences B2J7U2
WP_012411851.1.44837 63737.Npun_F5602 gi|186685654|ref|YP_001868850.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]