SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_012413288.1.44837 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012413288.1.44837
Domain Number 1 Region: 787-1011
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB transmembrane domain 7.19e-51
Family Multidrug efflux transporter AcrB transmembrane domain 0.0000801
Further Details:      
 
Domain Number 2 Region: 297-491
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB transmembrane domain 1.44e-45
Family Multidrug efflux transporter AcrB transmembrane domain 0.0000509
Further Details:      
 
Domain Number 3 Region: 136-181,268-324
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 1.65e-19
Family Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.0048
Further Details:      
 
Domain Number 4 Region: 42-125
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.00000000000000201
Family Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.0047
Further Details:      
 
Domain Number 5 Region: 704-789
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 0.00000000000000262
Family Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 0.0088
Further Details:      
 
Domain Number 6 Region: 182-265
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 0.000000000000484
Family Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 0.0076
Further Details:      
 
Domain Number 7 Region: 550-635
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.0000000000251
Family Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_012413288.1.44837
Sequence length 1013
Comment AcrB/AcrD/AcrF family protein [Nostoc punctiforme]; AA=GCF_000020025.1; RF=representative genome; TAX=63737; STAX=272131; NAME=Nostoc punctiforme PCC 73102; strain=ATCC 29133; PCC 73102; AL=Complete Genome; RT=Major
Sequence
MIRFTKLLQSQAKAIYLIFVLIAILGILAYGNVPSGVYPELSFPRIAVIAEAGNVAPEQV
VLTVTLPLEAATNQVYGVQKVRSKTTRGSTELSIEFQPTTDMQQALQQLQAKINEVRSTL
PSGVNLTVERVTPAIFPVLSYNVTTDTLAQTDLYSIAKYQILPRLTKVAGVALVNLQGGN
IPEVEVQVDPNRLQNYGLSLSQVADTIGRSTQNQAVGKLDSNYQQNLVVTNGQPIDSSAL
TGIVVTTKGAGKPVFLEDLGQVSLGEADRTQIVSAKGQPGLTLNIFRQPNSNVVAVAEAV
QQEIKLLEESLPPGVQIAKAYDESGLVVDAIANVRDSIAIGIVLIIIVLYVFLREWRSTV
IAAITIPLSALAAFGVLSFVGQSLNLMSLGGLAVAIGLVIDDAIVVIENIDRQLQKDLDS
TTAVAAAMAELTEPVISSTITTVAVFLPLGLLSGVAGQFFTSLTTTLTAAVGFSLVLALT
LTPLLAASWLRQKSNHSEPKLLVKLDNAYTGLLRVVFGKARWIGAIALSLLAVGAVLFTQ
VGSDFLPTFDEGSYIIDYLTPPGTSLTETDFLARQLEEIIGKTPEVINWTRRTGAENGLF
ATQPNKGDIIVVLKPPGQRQRQVFDIIETQRQDISKKLPQVDIDFHQILQDELNDLSGAA
SPVEVRIFGEEPAILRKLAEQVQTIIDNIPGLVDLVSSGGVILPQLDMRVDSTQAGQLGL
TESDVAQQVQDGLFGRVATQIRQGDKLVDVRVHLLDSVRRDPQQIDQIPIVGTNGTTLPL
SALATIKPTTGEEAILRENQQRYVSFTGGVEKRDLGSVVQDIKKKLAGFKLPQGYILSVG
GLIASQQQSFSQLLMVMGLGVLLVYLVLVIQFRDLLQPLVIFTTIPLALLGVVLSLWITQ
TPLNVSSFMGIILLVGLVVKNGIILLEYTNRLHSEGHSIESALLEAGRVRLRPILMTTLC
TILGLLPLALGLGAGAELQKPLAIAVIGGLSLSTIFTLIFVPAVFRIVSRFQR
Download sequence
Identical sequences B2JBH6
63737.Npun_BF152 gi|186687178|ref|YP_001870321.1| gi|186687178|ref|YP_001870321.1|NC_010632 WP_012413288.1.44837

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]