SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_012413351.1.44837 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012413351.1.44837
Domain Number 1 Region: 5-189
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 7.98e-57
Family Methylesterase CheB, C-terminal domain 0.0000445
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_012413351.1.44837
Sequence length 336
Comment chemotaxis protein CheB [Nostoc punctiforme]; AA=GCF_000020025.1; RF=representative genome; TAX=63737; STAX=272131; NAME=Nostoc punctiforme PCC 73102; strain=ATCC 29133; PCC 73102; AL=Complete Genome; RT=Major
Sequence
MLEHNIIVIGTSAGGVEALTYLVKHLPPDLKAAVIIVLHVSNHGTSVLPKILSRAGNLPA
SHAQDGEAIIHGRIYIAPPDYHLLVESVYLRLTRGPKENRHRPAIDTLFRSAARSYGQRA
IAVLLTGMLDDGTAGLVAIKMRGGVAIVQNPDDALHPDMPRNAIENVLDIDYIQPLSDIP
STLVALVNTPMKVEPENPIPDKMEFESSIVQLDLEAVKNEADRPGKPSIFGCPDCGGILW
ELEEGNLLRFRCRTGHAFSAETLLATQSDKVEDALWIAFRALEEKASLSHRMALRMEEHN
QALAAKRFKEQAESAWQHSAIIREILLKADTSTGVD
Download sequence
Identical sequences B2JBP3
gi|186687245|ref|YP_001870388.1| 63737.Npun_BF231 WP_012413351.1.44837 gi|186687245|ref|YP_001870388.1|NC_010632

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]