SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_012416711.1.73991 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012416711.1.73991
Domain Number 1 Region: 150-333
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 1.44e-59
Family Methylesterase CheB, C-terminal domain 0.000023
Further Details:      
 
Domain Number 2 Region: 1-105
Classification Level Classification E-value
Superfamily CheY-like 1.12e-19
Family CheY-related 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_012416711.1.73991
Sequence length 342
Comment chemotaxis response regulator protein-glutamate methylesterase [Bordetella avium]; AA=GCF_000070465.1; RF=representative genome; TAX=360910; STAX=521; NAME=Bordetella avium 197N; strain=197N; AL=Complete Genome; RT=Major
Sequence
MRVAIVNDMPLAVEALRRSLAHDPELSLAWIASDGLQAVRRCAADLPDVILMDLMMPVMN
GVEATRLIMAESPCAIIVVTSDVLQHTSLVFEAMGHGALDAVDTPVLGRGDPKAAAQRLL
RKIRNAGWLIGKKTVALERTTAMASSDTDAALVVIGASAGGPPSLAAVLRALPASFPAAI
VLVQHVDAAFTSGMAAWLNEQCVLPVRLASDGLRPEAGVVLLAGAGEHLVLGAERKLHYT
TEPRESVYSPSIDVFFHSVAQHWRGRAAGVLLTGMGQDGALGLKAMRERGFFTIAQDRAT
SAVYGMPKAAAALDAACEILPLGDIAPRLEKVFAPPANPLFN
Download sequence
Identical sequences Q2KV65
gi|187477524|ref|YP_785548.1| 360910.BAV1025 WP_012416711.1.34902 WP_012416711.1.73991

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]