SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_012417553.1.34902 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012417553.1.34902
Domain Number 1 Region: 5-180
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 8.02e-40
Family N-acetyl transferase, NAT 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_012417553.1.34902
Sequence length 186
Comment N-acetyltransferase [Bordetella avium]; AA=GCF_000813405.1; RF=na; TAX=521; STAX=521; NAME=Bordetella avium; strain=Nh1210; AL=Scaffold; RT=Major
Sequence
MRFIVIVLQTPRLILRSWHDADLPAFADLNADPDVMAHFPATLTREQSDALAKRLRQRMD
DHGFGLWAVQCLEATGKEGDFIGFVGLNRVPFEADFTPAVEIAWRLARPFWGRGYAIEAA
RACVAHGFGTLNLPRIDAFTVPANVRSRRVMETLGMRYTGEFEHPLLPPGHALRCHVRYQ
LERPNP
Download sequence
Identical sequences Q2L0K4
WP_012417553.1.34902 WP_012417553.1.73991 gi|187478378|ref|YP_786402.1| 360910.BAV1885

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]