SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_012417553.1.73991 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012417553.1.73991
Domain Number 1 Region: 5-180
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 8.02e-40
Family N-acetyl transferase, NAT 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_012417553.1.73991
Sequence length 186
Comment N-acetyltransferase [Bordetella avium]; AA=GCF_000070465.1; RF=representative genome; TAX=360910; STAX=521; NAME=Bordetella avium 197N; strain=197N; AL=Complete Genome; RT=Major
Sequence
MRFIVIVLQTPRLILRSWHDADLPAFADLNADPDVMAHFPATLTREQSDALAKRLRQRMD
DHGFGLWAVQCLEATGKEGDFIGFVGLNRVPFEADFTPAVEIAWRLARPFWGRGYAIEAA
RACVAHGFGTLNLPRIDAFTVPANVRSRRVMETLGMRYTGEFEHPLLPPGHALRCHVRYQ
LERPNP
Download sequence
Identical sequences Q2L0K4
360910.BAV1885 WP_012417553.1.34902 WP_012417553.1.73991 gi|187478378|ref|YP_786402.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]