SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_012419848.1.48500 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012419848.1.48500
Domain Number 1 Region: 807-1185
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 8.83e-116
Family PFOR PP module 0.0000000282
Further Details:      
 
Domain Number 2 Region: 430-681
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 5.75e-79
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.0000005
Further Details:      
 
Domain Number 3 Region: 10-262
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 3.14e-72
Family PFOR Pyr module 0.0000000723
Further Details:      
 
Domain Number 4 Region: 263-427
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 2.22e-42
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain II 0.0000143
Further Details:      
 
Domain Number 5 Region: 667-771
Classification Level Classification E-value
Superfamily alpha-helical ferredoxin 3.24e-21
Family Fumarate reductase/Succinate dehydogenase iron-sulfur protein, C-terminal domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_012419848.1.48500
Sequence length 1192
Comment pyruvate:ferredoxin (flavodoxin) oxidoreductase [Akkermansia muciniphila]; AA=GCF_900184855.1; RF=na; TAX=239935; STAX=239935; NAME=Akkermansia muciniphila; AL=Contig; RT=Major
Sequence
MSDQTTVTYSTIDANEAVASVAYRFSEVIAIYPITPSSPMGESAESWAAVNRKNLWGTVP
SVVEMQSEGGAAGTVHGALQTGALATTFTASQGLLLMIPNMFKIAGELTPAVFHVAARSL
AYQALSIFGDHSDVMSARSCGWAMLCGSSTQEAADFAAISHAATLESRIPFINFFDGFRT
SHEIGKIADITDDTLNGMIKQEWLDSFRERALTPDAPVLRGTAQNPDVYFQGRETVNRFY
EATPAIVQNAMDKFAELTGRSYHLVDYTGAPDAERVIILMGSGAEAVEETVEAMMTRENA
KVGVLKVRLFRPFPAAELVKALPATVRKIAVLDRTKEPGSQGEPLHQDIIQALFDAQANG
TLPFTNGMPKVVGGRYGLSSKEFTPAMVKGVYDNLALDTPKNHFTIGINDDVLGTSLPYD
EDYSTEADDVTRAMFFGLGSDGTVGANKDAIKIIGQHTNLYVQGYFVYDSKKSGSSTISH
LRFGPRPIKSTYLITKANFLALHQPSLLDLFDFLKNAANGATFLMNSPHPADKLWDTLPA
RMQQQILDKNIKLYTIDAFAVARKTGMGGRINMIMQTCFFKLASVIPADEAIGYIKKAIA
KTYAKKGQEVVDKNIAAVDATLENLHQVDTTGKTVNGHAIPPAMSPDAPDYVQNVLGKMM
CGEGDSIPVSQMPVDGTFPNGTSQYEKRNLALDLPEWDPTLCIQCGKCTAVCPHAVIRSK
FFSPDALANAPEGFECLDAKHPDWKGEKFVIQISPNDCTGCTLCADVCPAKSKTDPTHKA
LTMVPAGKIHDKEEANWNFFLSLPDVDRTKVRTDNIRSMQVLRPLFEFSGACAGCGETPY
VKMLSQLFGNRLVVANATGCSSIYGGNLPTTPWSHDSEGRGPAWANSLFEDNAEFGLGFR
VSLDKQMEHAIELLHEAAGAVGQELVDRILANPQKDEADIAQQRENIEELKKKIAGKPEY
ARLLTLADKLVRKSVWILGGDGWAYDIGYGGLDHILASGRNVKVLVMDTEVYSNTGGQCS
KSTPRAAVAKFATNGKPGVKKDLGLMAMTYGNVYVASVALGAKDEHTLKAFVEAEAYDGP
ALIIAYSHCISHGINMAKGLQQQKAWVDSGRVLLYRYNPDLARQGKNPLIVEGKGPKGDL
RDVLLSENRFKLLAKTNKEGFEKLLEEAQKDVWHRWNLYQSIAGMGADKPAE
Download sequence
Identical sequences A0A1Y3SRX6 B2UQ98
349741.Amuc_0799 gi|187735302|ref|YP_001877414.1| WP_012419848.1.11081 WP_012419848.1.13503 WP_012419848.1.26090 WP_012419848.1.31314 WP_012419848.1.44559 WP_012419848.1.48500 WP_012419848.1.52179 WP_012419848.1.55880 WP_012419848.1.65144 WP_012419848.1.67314 WP_012419848.1.75205 WP_012419848.1.86927 WP_012419848.1.87234

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]