SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_012428274.1.30149 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012428274.1.30149
Domain Number 1 Region: 116-369
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 4.72e-66
Family D-glucarate dehydratase-like 0.00036
Further Details:      
 
Domain Number 2 Region: 1-132
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 1.84e-30
Family Enolase N-terminal domain-like 0.00061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_012428274.1.30149
Sequence length 377
Comment mandelate racemase [Paraburkholderia phytofirmans]; AA=GCF_000020125.1; RF=na; TAX=398527; STAX=261302; NAME=Paraburkholderia phytofirmans PsJN; strain=PsJN; AL=Complete Genome; RT=Major
Sequence
MKIADIVAYPVTVPVPPQYQVSLGIGRMVKRDTVIVKVTTDEGIVGWGESHHGRAHLAIA
MLVNTTLKQLVADLEATDVNGVWSQIYRYQLASHGMGAACAAAMSGIDMALWDIRGKATG
WPLYRLLGGTSRSVPAYAGGICLGFQTPSALLEEVETMVRRGYKAIKLRLGDSPANDIAR
VAAVREAYPELDILTDANTAYSLRDFRMVAPHLDAAHVGWLEEPFPAHDYRSYREAKKMC
RFALAGGENHFTRFEFAQLIDAESITILQPDLSKVGGISEAMKVATMASVQKLPVHCHSS
MGINMAATLHVLSAIDNAGYFEADCSLYNPLRDDLIDFSFAINADGTLRPSEKPGIGIEI
NEDFIKHHAGSSGPGFV
Download sequence
Identical sequences B2T8V3
398527.Bphyt_6459 gi|187921105|ref|YP_001890137.1| WP_012428274.1.30149

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]