SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_012428341.1.30149 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012428341.1.30149
Domain Number 1 Region: 15-94
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 0.00000000000000182
Family 2Fe-2S ferredoxin domains from multidomain proteins 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_012428341.1.30149
Sequence length 130
Comment hypothetical protein [Paraburkholderia phytofirmans]; AA=GCF_000020125.1; RF=na; TAX=398527; STAX=261302; NAME=Paraburkholderia phytofirmans PsJN; strain=PsJN; AL=Complete Genome; RT=Major
Sequence
MFRKLQDPSLADTLQITVDGEAVGAMEGETVAGVLMRRAVLLTRQTPVSGMLRAPYCMMG
VCFECLAVVDGIASVQTCLTTVRDGMCVERQRGRRTVELEVCSGRDFTEDGEREAAPPRE
DEAVRDEKKI
Download sequence
Identical sequences B2TB95
gi|187921176|ref|YP_001890208.1| WP_012428341.1.30149 398527.Bphyt_6534

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]